Recent orders

Intrinsic and extrinsic motivation factors and job satisfaction

Intrinsic and extrinsic motivation factors and job satisfaction

After working through the Theoretical Foundations Powerpoint, select only one of the theories and discuss its usefulness in the context of managing organizations. Use online peer-reviewed journal research (case study research is best) to inform your writing and to advance the theoretical discussion beyond what you encountered in the PowerPoint. You may select a theory you will eventually use elsewhere in the course.

Identify the consequences of having dissatisfied employees and describe ways of applying the four theories of job satisfaction and how you would use them to boost job satisfaction. Discuss how intrinsic and extrinsic motivation factors affect job satisfaction.

When answering, consider how goals may help with job satisfaction and how to design jobs to enhance motivation.

Compare and contrast contemporary issues and opportunities with the SDGs

Compare and contrast contemporary issues and opportunities with the SDGs

Compare and contrast contemporary issues and opportunities with the SDGs between two countries in the Asia Pacific Region.

Word limit: 2000 words
You require a minimum of six (6) sources. This can include journal articles, book chapters, websites and government reports. Of these, at least two (2) must be academic, peer-reviewed publications.
In-text references are part of the word limit

Genetics Questions and Answers for Revision

Genetics Questions and Answers for Revision

Question 1

Demonstrate your understanding in the basic concepts of molecular genetics by critically evaluating the following statements:

Question 1a

The statistical significance of a BLAST result can be assessed through E-values.

(5 marks)

Question 1b

When comparing two sequences, it may be necessary to repeat the search using different scoring matrices.

(5 marks)

Question 1c

Protein alignments are often more informative than DNA alignments.

(5 marks)

Question 1d

Position specific iterated BLAST (PSI-BLAST) is often more sensitive than a regular BLAST search in finding distantly related protein sequences.

(5 marks)

Question 1e

Benchmarking is an important approach to compare different software and to determine their accuracy.

(5 marks)

Question 2

You have been assigned the task of determining the functional importance of the human CFTR gene. Investigate and solve the following questions:

Question 2a

List the full name and gene ID of this gene and the RefSeq IDs of its corresponding mRNA and protein.

(5 marks)

Question 2b

State the chromosome in which the human CFTR gene is found on, and in the tissues where it shows high expression.

(5 marks)

Question 2c

Discuss the function of this gene.

(5 marks)

Question 2d

List any FIVE (5) pathways this gene is involved in, using Reactome pathway database as the source.

(5 marks)

Question 3

Using the Molecular Signatures Database (MSigDB) information for Fatty Acid Metabolism

(http://www.gsea- msigdb.org/gsea/msigdb/cards/HALLMARK_FATTY_ACID_METABOLISM.html), assemble the following tasks:

Question 3a

Pull out the 158 genes involved in the metabolism of fatty acids, and use the list as input in the online tool DAVID (Database for Annotation, Visualization and Integrated Discovery).

(5 marks)

Question 3b

Perform a functional annotation clustering of the gene list by only selecting the following: GOTERM_BP/CC/MF_DIRECT, REACTOME_PATHWAY and KEGG_PATHWAY. Attach a screenshot of the top THREE (3) annotation clusters on the basis of the enrichment score.

(5 marks)

Question 3c

Appraise the results obtained and discuss how relevant the findings are to the gene list.

(5 marks)

Question 4

Using the NCBI’s HomoloGene resource and the ID: 4349, obtain sequences (one each) from Human and organisms such as B. taurus, M. musculus, D. rerio, C. elegans.

Question 4a

Attach the sequences in fasta format.

(5 marks)

Question 4b

Create a multiple sequence alignment using any multiple sequence alignment tool and attach the alignment and the phylogenetic tree.

(10 marks)

Question 4c

Evaluate the alignment and the phylogenetic tree derived from the alignment.

(5 marks)

Question 5

With the help of an alignment tool you have learnt, investigate the given human sequence and furnish answers to the following questions:

>SEQ MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP EGLFLQDNIVAEFSVDETGQ MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGN DDHWIVDTDYDTYAVQYSCR LLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC DGRSERNLL

Question 5a

Determine the name and accession number of the sequence.

(5 marks)

Question 5b

Identify the conserved domains/features in this sequence.

(5 marks)

Question 5c

State the superfamily in which the sequence belongs to. Discuss its functional role.

(5 marks)

Question 5d

List FIVE (5) pathways its genic form is involved in.

(5 marks)